Home| Contact Us

HOME SEARCH STATISTICS
Peptides (NX_O60500-1)
to neXtProt Sequence Information of Isoform
Start-end (length)PeptidesCo#
2-8 (8) MALGTTLR PA
1
9-32 (24) ASLLLLGLLTEGLAQLAIPASVPR PA
1
33-52 (20) GFWALPENLTVVEGASVELR PA
1
53-66 (14) CGVSTPGSAVQWAK PA
1
67-76 (10) DGLLLGPDPR PA
1
92-115 (24) GEFHLHIEACDLSDDAEYECQVGR PA
1
116-126 (11) SEMGPELVSPR PA
1
127-136 (10) VILSILVPPK PA
1
137-194 (58) LLLLTPEAGTMVTWVAGQEYVVNCVSGDAKPAPDITILLSGQTISDISANVNEGSQQK PA
1
195-203 (9) LFTVEATAR PA
1
213-229 (17) QLLVCEASSPALEAPIK PA
1
230-256 (27) ASFTVNVLFPPGPPVIEWPGLDEGHVR PA
1
257-268 (12) AGQSLELPCVAR PA
1
269-280 (12) GGNPLATLQWLK PA
1
281-299 (19) NGQPVSTAWGTEHTQAVAR PA
1
300-355 (56) SVLVMTVRPEDHGAQLSCEAHNSVSAGTQEHGITLQVTFPPSAIIILGSASQTENK PA
1
356-364 (9) NVTLSCVSK PA
1
380-407 (28) QLLPMEETVMDGLHGGHISMSNLTFLAR PA
1
409-426 (18) EDNGLTLTCEAFSEAFTK PA
1
444-454 (11) LWIEGPPEGQK PA
1
463-480 (18) LVCLAIGGNPEPSLMWYK PA
1
497-504 (8) VHLGSVEK PA
1
512-525 (14) ELVLVTGPSDNQAK PA
1
530-582 (53) AGQLSASTQLAVQFPPTNVTILANASALRPGDALNLTCVSVSSNPPVNLSWDK PA
1
587-595 (9) LEGVAAPPR PA
1
607-615 (9) SVLLQVSSR PA
1
632-639 (8) ETVSSFYR PA
1
640-684 (45) LNVLYRPEFLGEQVLVVTAVEQGEALLPVSVSANPAPEAFNWTFR PA
1
688-695 (8) LSPAGGPR PA
1
698-711 (14) ILSSGALHLWNVTR PA
1
712-731 (20) ADDGLYQLHCQNSEGTAEAR PA
1
734-743 (10) LDVHYAPTIR PA
1
744-777 (34) ALQDPTEVNVGGSVDIVCTVDANPILPGMFNWER PA
1
778-792 (15) LGEDEEDQSLDDMEK PA
1
808-827 (20) LAQAGAYQCIVDNGVAPPAR PA
1
836-848 (13) FAPQVEHPTPLTK PA
1
849-864 (16) VAAAGDSTSSATLHCR PA
1
867-877 (11) GVPNIVFTWTK PA
1
878-888 (11) NGVPLDLQDPR PA
1
889-948 (60) YTEHTYHQGGVHSSLLTIANVSAAQDYALFTCTATNALGSDQTNIQLVSISRPDPPSGLK PA
1
949-972 (24) VVSLTPHSVGLEWKPGFDGGLPQR PA
1
977-1008 (32) YEALGTPGFHYVDVVPPQATTFTLTGLQPSTR PA
1
1011-1027 (17) VWLLASNALGDSGLADK PA
1
1028-1088 (61) GTQLPITTPGLHQPSGEPEDQLPTEPPSGPSGLPLLPVLFALGGLLLLSNASCVGGVLWQR PA
0
1093-1100 (8) LAEGISEK PA
0
1101-1109 (9) TEAGSEEDR PA
1
1112-1123 (12) NEYEESQWTGER PA
1
1124-1140 (17) DTQSSTVSTTEAEPYYR PA
1
1144-1160 (17) DFSPQLPPTQEEVSYSR PA
1
1161-1181 (21) GFTGEDEDMAFPGHLYDEVER PA
1
1182-1214 (33) TYPPSGAWGPLYDEVQMGPWDLHWPEDTYQDPR PA
1
1215-1237 (23) GIYDQVAGDLDTLEPDSLPFELR PA
1
: Uniquely mapped peptide
: Gene-specific peptide
: Shared peptide

#424, YPRC/BPRC, Industry-University Research Center, Yonsei Univ., Seodaemun-gu, Seoul, Korea, 120-749
Tel: +82-2-2123-6626, Fax: +82-2-393-6589
2014-2019 (C) Yonsei Proteome Research Center