Home| Contact Us

HOME SEARCH STATISTICS
Peptides (NX_O60543-1)
to neXtProt Sequence Information of Isoform
Start-end (length)PeptidesCo#
6-23 (18) DYAGALIRPLTFMGSQTK PA
0
25-38 (14) VLFTPLMHPARPFR PA
0
49-61 (13) GVMASSLQELISK PA
0
62-104 (43) TLDALVIATGLVTLVLEEDGTVVDTEEFFQTLGDNTHFMILEK PA
0
108-122 (15) WMPGSQHVPTCSPPK PA
0
140-148 (9) DFIGCLNVK PA
0
149-162 (14) ATMYEMYSVSYDIR PA
0
176-197 (22) FLSYSAQVTGQFLIYLGTYMLR PA
0
: Uniquely mapped peptide
: Gene-specific peptide
: Shared peptide

#424, YPRC/BPRC, Industry-University Research Center, Yonsei Univ., Seodaemun-gu, Seoul, Korea, 120-749
Tel: +82-2-2123-6626, Fax: +82-2-393-6589
2014-2019 (C) Yonsei Proteome Research Center