Home| Contact Us

HOME SEARCH STATISTICS
Peptides (NX_O60664-2)
to neXtProt Sequence Information of Isoform
Start-end (length)PeptidesCo#
2-12 (12) MVLSGVDTVLGK PA
0
13-30 (18) SEEWADNHLPLTDAELAR PA
3
31-47 (17) IATSLDGFDVASVQQQR PA
3
48-55 (8) QEQSYFVR PA
3
65-74 (10) QHAYEHSLGK PA
3
82-100 (19) AQEALLQLSQVLSLMETVK PA
3
114-124 (11) LHQMWLSWNQK PA
3
132-142 (11) EPPKPEQVESR PA
2
149-173 (25) DIAQQLQATCTSLGSSIQGLPTNVK PA
3
182-208 (27) QVEDLQATFSSIHSFQDLSSSILAQSR PA
3
216-245 (30) EALDHMVEYVAQNTPVTWLVGPFAPGITEK PA
3
: Uniquely mapped peptide
: Gene-specific peptide
: Shared peptide

#424, YPRC/BPRC, Industry-University Research Center, Yonsei Univ., Seodaemun-gu, Seoul, Korea, 120-749
Tel: +82-2-2123-6626, Fax: +82-2-393-6589
2014-2019 (C) Yonsei Proteome Research Center