Home| Contact Us

HOME SEARCH STATISTICS
Peptides (NX_O60664-4)
to neXtProt Sequence Information of Isoform
Start-end (length)PeptidesCo#
2-28 (28) MSADGAEADGSTQVTVEEPVQQPSVVDR PA
2
29-50 (22) VASMPLISSTCDMVSAAYASTK PA
2
58-65 (8) TVCDAAEK PA
2
69-84 (16) TLTAAAVSGAQPILSK PA
2
85-98 (14) LEPQIASASEYAHR PA
2
103-116 (14) LEENLPILQQPTEK PA
2
117-128 (12) VSGAQEMVSSAK PA
2
129-143 (15) DTVATQLSEAVDATR PA
2
144-152 (9) GAVQSGVDK PA
2
155-168 (14) SVVTGGVQSVMGSR PA
2
169-183 (15) LGQMVLSGVDTVLGK PA
2
184-201 (18) SEEWADNHLPLTDAELAR PA
3
202-218 (17) IATSLDGFDVASVQQQR PA
3
219-226 (8) QEQSYFVR PA
3
236-245 (10) QHAYEHSLGK PA
3
253-271 (19) AQEALLQLSQVLSLMETVK PA
3
285-295 (11) LHQMWLSWNQK PA
3
303-313 (11) EPPKPEQVESR PA
2
320-344 (25) DIAQQLQATCTSLGSSIQGLPTNVK PA
3
353-379 (27) QVEDLQATFSSIHSFQDLSSSILAQSR PA
3
387-416 (30) EALDHMVEYVAQNTPVTWLVGPFAPGITEK PA
3
: Uniquely mapped peptide
: Gene-specific peptide
: Shared peptide

#424, YPRC/BPRC, Industry-University Research Center, Yonsei Univ., Seodaemun-gu, Seoul, Korea, 120-749
Tel: +82-2-2123-6626, Fax: +82-2-393-6589
2014-2019 (C) Yonsei Proteome Research Center