Home| Contact Us

HOME SEARCH STATISTICS
Peptides (NX_O60885-1)
to neXtProt Sequence Information of Isoform
Start-end (length)PeptidesCo#
2-10 (10) MSAESGPGTR PA
2
13-57 (45) NLPVMGDGLETSQMSTTQAQAQPQPANAASTNPPPPETSNPNKPK PA
2
59-68 (10) QTNQLQYLLR PA
2
77-91 (15) HQFAWPFQQPVDAVK PA
2
92-99 (8) LNLPDYYK PA
2
103-111 (9) TPMDMGTIK PA
2
114-155 (42) LENNYYWNAQECIQDFNTMFTNCYIYNKPGDDIVLMAEALEK PA
2
161-177 (17) INELPTEETEIMIVQAK PA
2
185-283 (99) ETGTAKPGVSTVPNTTQASTPPQTQTPQPNPPPVQATPHPFPAVTPDLIVQTPVMTVVPPQPLQTPPPVPPQPQPPPAPA
PQPVQSHPPIIAATPQPVK PA
2
292-314 (23) ADTTTPTTIDPIHEPPSLPPEPK PA
2
323-332 (10) ESSRPVKPPK PA
2
334-346 (13) DVPDSQQHPAPEK PA
2
369-395 (27) HAAYAWPFYKPVDVEALGLHDYCDIIK PA
2
396-404 (9) HPMDMSTIK PA
2
414-423 (10) DAQEFGADVR PA
2
424-431 (8) LMFSNCYK PA
8
432-444 (13) YNPPDHEVVAMAR PA
4
446-453 (8) LQDVFEMR PA
4
457-478 (22) MPDEPEEPVVAVSSPAVPPPTK PA
2
479-507 (29) VVAPPSSSDSSSDSSSDSDSSTDDSEEER PA
2
511-519 (9) LAELQEQLK PA
4
520-537 (18) AVHEQLAALSQPQQNKPK PA
2
576-585 (10) NNSSNSNVSK PA
2
593-606 (14) SKPPPTYESEEEDK PA
2
607-615 (9) CKPMSYEEK PA
2
617-624 (8) QLSLDINK PA
6
633-640 (8) VVHIIQSR PA
8
646-665 (20) NSNPDEIEIDFETLKPSTLR PA
2
686-694 (9) VDVIAGSSK PA
2
697-724 (28) GFSSSESESSSESSSSDSEDSETEMAPK PA
0
738-794 (57) HHHHHHQQMQQAPAPVPQQPPPPPQQPPPPPPPQQQQQPPPPPPPPSMPQQAAPAMK PA
0
795-876 (82) SSPPPFIATQVPVLEPQLPGSVFDPIGHFTQPILHLPQPELPPHLPQPPEHSTPPHLNQHAVVSPPALHNALPQQPSRPSNR PA
0
877-937 (61) AAALPPKPARPPAVSPALTQTPLLPQPPMAQPPQVLLEDEEPPAPPLTSMQMQLYLQQLQK PA
0
938-949 (12) VQPPTPLLPSVK PA
0
950-1047 (98) VQSQPPPPLPPPPHPSVQQQLQQQPPPPPPPQPQPPPQQQHQPPPRPVHLQPMQFSTHIQQPPPPQGQQPPHPPPGQQPPPPQPAKPQQVIQHHHSPR PA
0
1051-1060 (10) SDPYSTGHLR PA
0
1061-1092 (32) EAPSPLMIHSPQMSQFQSLTHQSPPQQNVQPK PA
0
1098-1111 (14) AASVVQPQPLVVVK PA
0
1122-1135 (14) SEPFSPSLRPEPPK PA
0
1142-1177 (36) APVHLPQRPEMKPVDVGRPVIRPPEQNAPPPGAPDK PA
0
1198-1208 (11) NMGSWASLVQK PA
0
1209-1218 (10) HPTTPSSTAK PA
0
1219-1228 (10) SSSDSFEQFR PA
0
1243-1250 (8) AQAEHAEK PA
0
1264-1273 (10) EDEDALEQAR PA
0
1283-1290 (8) QEQQQQQR PA
0
1291-1325 (35) QEQQQQQQQQAAAVAAAATPQAQSSQPQSMLDQQR PA
0
1339-1362 (24) EAMAATIDMNFQSDLLSIFEENLF PA
0
: Uniquely mapped peptide
: Gene-specific peptide
: Shared peptide

#424, YPRC/BPRC, Industry-University Research Center, Yonsei Univ., Seodaemun-gu, Seoul, Korea, 120-749
Tel: +82-2-2123-6626, Fax: +82-2-393-6589
2014-2019 (C) Yonsei Proteome Research Center