Home| Contact Us

HOME SEARCH STATISTICS
Peptides (NX_O60896-1)
to neXtProt Sequence Information of Isoform
Start-end (length)PeptidesCo#
8-24 (17) RPQLLPLLLLLCGGCPR PA
0
25-36 (12) AGGCNETGMLER PA
0
43-50 (8) AFADMMGK PA
0
56-98 (43) WCNLSEFIVYYESFTNCTEMEANVVGCYWPNPLAQGFITGIHR PA
0
99-108 (10) QFFSNCTVDR PA
0
109-140 (32) VHLEDPPDEVLIPLIVIPVVLTVAMAGLVVWR PA
0
: Uniquely mapped peptide
: Gene-specific peptide
: Shared peptide

#424, YPRC/BPRC, Industry-University Research Center, Yonsei Univ., Seodaemun-gu, Seoul, Korea, 120-749
Tel: +82-2-2123-6626, Fax: +82-2-393-6589
2014-2019 (C) Yonsei Proteome Research Center