Home| Contact Us

HOME SEARCH STATISTICS
Peptides (NX_O60921-1)
to neXtProt Sequence Information of Isoform
Start-end (length)PeptidesCo#
7-18 (12) IVDGACLNHFTR PA
0
39-46 (8) LNFILCDK PA
1
47-90 (44) LANGGVSMWCELEQENFFNEFQMEGVSAENNEIYLELTSENLSR PA
1
109-127 (19) HFPCLTVSVELLSMSSSSR PA
1
128-136 (9) IVTHDIPIK PA
1
145-164 (20) DLQEPVVPDPDVSIYLPVLK PA
1
175-193 (19) NISNHLVIEANLDGELNLK PA
1
194-206 (13) IETELVCVTTHFK PA
1
207-222 (16) DLGNPPLASESTHEDR PA
1
223-235 (13) NVEHMAEVHIDIR PA
1
237-250 (14) LLQFLAGQQVNPTK PA
1
251-259 (9) ALCNIVNNK PA
1
260-280 (21) MVHFDLLHEDVSLQYFIPALS PA
1
: Uniquely mapped peptide
: Gene-specific peptide
: Shared peptide

#424, YPRC/BPRC, Industry-University Research Center, Yonsei Univ., Seodaemun-gu, Seoul, Korea, 120-749
Tel: +82-2-2123-6626, Fax: +82-2-393-6589
2014-2019 (C) Yonsei Proteome Research Center