Home| Contact Us

HOME SEARCH STATISTICS
Peptides (NX_O60921-2)
to neXtProt Sequence Information of Isoform
Start-end (length)PeptidesCo#
18-25 (8) LNFILCDK PA
1
26-69 (44) LANGGVSMWCELEQENFFNEFQMEGVSAENNEIYLELTSENLSR PA
1
88-106 (19) HFPCLTVSVELLSMSSSSR PA
1
107-115 (9) IVTHDIPIK PA
1
124-143 (20) DLQEPVVPDPDVSIYLPVLK PA
1
154-172 (19) NISNHLVIEANLDGELNLK PA
1
173-185 (13) IETELVCVTTHFK PA
1
186-201 (16) DLGNPPLASESTHEDR PA
1
202-214 (13) NVEHMAEVHIDIR PA
1
216-229 (14) LLQFLAGQQVNPTK PA
1
230-238 (9) ALCNIVNNK PA
1
239-259 (21) MVHFDLLHEDVSLQYFIPALS PA
1
: Uniquely mapped peptide
: Gene-specific peptide
: Shared peptide

#424, YPRC/BPRC, Industry-University Research Center, Yonsei Univ., Seodaemun-gu, Seoul, Korea, 120-749
Tel: +82-2-2123-6626, Fax: +82-2-393-6589
2014-2019 (C) Yonsei Proteome Research Center