Home| Contact Us

HOME SEARCH STATISTICS
Peptides (NX_O75150-1)
to neXtProt Sequence Information of Isoform
Start-end (length)PeptidesCo#
9-20 (12) AAGDGGSGPPEK PA
2
28-37 (10) TTTTLIEPIR PA
2
38-50 (13) LGGISSTEEMDLK PA
2
67-74 (8) QACEDELR PA
2
84-96 (13) QATDDATLLIVNR PA
2
97-110 (14) YWAQLDETVEALLR PA
2
111-147 (37) CHESQGELSSAPEAPGTQEGPTCDGTPLPEPGTSELR PA
2
148-184 (37) DPLLMQLRPPLSEPALAFVVALGASSSEEVELELQGR PA
2
217-231 (15) GDSEPLSEAAQAHTR PA
2
240-250 (11) LQDLATQLQEK PA
2
254-264 (11) ISLEYSELQDK PA
2
272-288 (17) VLEMETTVEDLQWDIEK PA
2
299-331 (33) HLAEALEQLNSGYYVSGSSSGFQGGQITLSMQK PA
2
332-349 (18) FEMLNAELEENQELANSR PA
1
356-365 (10) LQAELQGAVR PA
1
376-383 (8) SLPEEVVR PA
1
390-406 (17) MLQAQFSLLYNESLQVK PA
1
426-439 (14) HIEHMESDELGLQK PA
1
443-456 (14) TEVIQLEDTLAQVR PA
3
464-481 (18) IEFEQNLAANEQAGPINR PA
2
485-498 (14) HLISSLQNHNHQLK PA
3
510-517 (8) EVQAEIGK PA
2
520-547 (28) AQASGSAHSTPNLGHPEDSGVSAPAPGK PA
2
548-561 (14) EEGGPGPVSTPDNR PA
2
563-578 (16) EMAPVPGTTTTTTSVK PA
2
580-602 (23) EELVPSEEDFQGITPGAQGPSSR PA
2
618-633 (16) EGPSLGPPPVASALSR PA
2
687-694 (8) VQLMAAER PA
2
721-728 (8) IADEDALR PA
2
732-742 (11) QAEEQIEHLQR PA
2
749-774 (26) QEEEALLSEMDVTGQAFEDMQEQNGR PA
2
808-818 (11) DELGEQVLGLK PA
2
819-830 (12) SQVDAQLLTVQK PA
1
837-847 (11) ALQGSLGGVEK PA
1
853-860 (8) SQALELNK PA
1
863-874 (12) AVEAAQLAEDLK PA
1
875-883 (9) VQLEHVQTR PA
1
886-895 (10) EIQPCLAESR PA
1
925-940 (16) VEVYADADEILQEEIK PA
1
946-954 (9) LTCPCCNTR PA
1
963-973 (11) CFHVFCFECVR PA
1
986-997 (12) CNAAFGAHDFHR PA
1
: Uniquely mapped peptide
: Gene-specific peptide
: Shared peptide

#424, YPRC/BPRC, Industry-University Research Center, Yonsei Univ., Seodaemun-gu, Seoul, Korea, 120-749
Tel: +82-2-2123-6626, Fax: +82-2-393-6589
2014-2019 (C) Yonsei Proteome Research Center