Home| Contact Us

HOME SEARCH STATISTICS
Peptides (NX_O75150-4)
to neXtProt Sequence Information of Isoform
Start-end (length)PeptidesCo#
9-20 (12) AAGDGGSGPPEK PA
2
28-37 (10) TTTTLIEPIR PA
2
38-50 (13) LGGISSTEEMDLK PA
2
67-74 (8) QACEDELR PA
2
84-96 (13) QATDDATLLIVNR PA
2
97-110 (14) YWAQLDETVEALLR PA
2
111-147 (37) CHESQGELSSAPEAPGTQEGPTCDGTPLPEPGTSELR PA
2
148-184 (37) DPLLMQLRPPLSEPALAFVVALGASSSEEVELELQGR PA
2
217-231 (15) GDSEPLSEAAQAHTR PA
2
240-250 (11) LQDLATQLQEK PA
2
254-264 (11) ISLEYSELQDK PA
2
272-288 (17) VLEMETTVEDLQWDIEK PA
2
299-331 (33) HLAEALEQLNSGYYVSGSSSGFQGGQITLSMQK PA
2
332-339 (8) SDELGLQK PA
0
343-356 (14) TEVIQLEDTLAQVR PA
3
364-381 (18) IEFEQNLAANEQAGPINR PA
2
385-398 (14) HLISSLQNHNHQLK PA
3
410-417 (8) EVQAEIGK PA
2
420-447 (28) AQASGSAHSTPNLGHPEDSGVSAPAPGK PA
2
448-461 (14) EEGGPGPVSTPDNR PA
2
463-478 (16) EMAPVPGTTTTTTSVK PA
2
480-502 (23) EELVPSEEDFQGITPGAQGPSSR PA
2
518-533 (16) EGPSLGPPPVASALSR PA
2
587-594 (8) VQLMAAER PA
2
621-628 (8) IADEDALR PA
2
632-642 (11) QAEEQIEHLQR PA
2
649-674 (26) QEEEALLSEMDVTGQAFEDMQEQNGR PA
2
708-718 (11) DELGEQVLGLK PA
2
719-730 (12) SQVDAQLLTVQK PA
1
737-747 (11) ALQGSLGGVEK PA
1
753-760 (8) SQALELNK PA
1
763-774 (12) AVEAAQLAEDLK PA
1
775-783 (9) VQLEHVQTR PA
1
786-795 (10) EIQPCLAESR PA
1
825-840 (16) VEVYADADEILQEEIK PA
1
846-854 (9) LTCPCCNTR PA
1
863-873 (11) CFHVFCFECVR PA
1
886-897 (12) CNAAFGAHDFHR PA
1
: Uniquely mapped peptide
: Gene-specific peptide
: Shared peptide

#424, YPRC/BPRC, Industry-University Research Center, Yonsei Univ., Seodaemun-gu, Seoul, Korea, 120-749
Tel: +82-2-2123-6626, Fax: +82-2-393-6589
2014-2019 (C) Yonsei Proteome Research Center