Home| Contact Us

HOME SEARCH STATISTICS
Peptides (NX_O75208-1)
to neXtProt Sequence Information of Isoform
Start-end (length)PeptidesCo#
2-12 (12) MAAAAVSGALGR PA
1
36-45 (10) AFHASAVGLR PA
1
52-81 (30) QQPPNSFSQQHSETQGAEKPDPESSHSPPR PA
1
82-102 (21) YTDQGGEEEEDYESEEQLQHR PA
1
103-140 (38) ILTAALEFVPAHGWTAEAIAEGAQSLGLSSAAASMFGK PA
0
141-156 (16) DGSELILHFVTQCNTR PA
0
167-175 (9) LVQLGQAEK PA
0
192-202 (11) MLIPYIEHWPR PA
0
203-243 (41) ALSILMLPHNIPSSLSLLTSMVDDMWHYAGDQSTDFNWYTR PA
0
245-271 (27) AMLAAIYNTTELVMMQDSSPDFEDTWR PA
0
277-288 (12) VNDAMNMGHTAK PA
0
292-309 (18) STGEALVQGLMGAAVTLK PA
0
310-317 (8) NLTGLNQR PA
0
: Uniquely mapped peptide
: Gene-specific peptide
: Shared peptide

#424, YPRC/BPRC, Industry-University Research Center, Yonsei Univ., Seodaemun-gu, Seoul, Korea, 120-749
Tel: +82-2-2123-6626, Fax: +82-2-393-6589
2014-2019 (C) Yonsei Proteome Research Center