Home| Contact Us

HOME SEARCH STATISTICS
Peptides (NX_O75309-1)
to neXtProt Sequence Information of Isoform
Start-end (length)PeptidesCo#
2-19 (19) MVPAWLWLLCVSVPQALPK PA
3
20-43 (24) AQPAELSVEVPENYGGNFPLYLTK PA
3
49-63 (15) EGAEGQIVLSGDSGK PA
3
64-82 (19) ATEGPFAMDPDSGFLLVTR PA
3
87-117 (31) EEQAEYQLQVTLEMQDGHVLWGPQPVLVHVK PA
3
118-132 (15) DENDQVPHFSQAIYR PA
2
138-153 (16) GTRPGIPFLFLEASDR PA
2
154-164 (11) DEPGTANSDLR PA
2
165-185 (21) FHILSQAPAQPSPDMFQLEPR PA
2
186-194 (9) LGALALSPK PA
2
195-205 (11) GSTSLDHALER PA
2
206-214 (9) TYQLLVQVK PA
2
215-251 (37) DMGDQASGHQATATVEVSIIESTWVSLEPIHLAENLK PA
2
252-292 (41) VLYPHHMAQVHWSGGDVHYHLESHPPGPFEVNAEGNLYVTR PA
3
297-307 (11) EAQAEYLLQVR PA
3
308-339 (32) AQNSHGEDYAAPLELHVLVMDENDNVPICPPR PA
3
340-357 (18) DPTVSIPELSPPGTEVTR PA
3
358-389 (32) LSAEDADAPGSPNSHVVYQLLSPEPEDGVEGR PA
3
390-408 (19) AFQVDPTSGSVTLGVLPLR PA
3
409-484 (76) AGQNILLLVLAMDLAGAEGGFSSTCEVEVAVTDINDHAPEFITSQIGPISLPEDVEPGTLVAMLTAIDADLEPAFR PA
3
485-492 (8) LMDFAIER PA
3
493-511 (19) GDTEGTFGLDWEPDSGHVR PA
3
517-537 (21) NLSYEAAPSHEVVVVVQSVAK PA
3
538-557 (20) LVGPGPGPGATATVTVLVER PA
3
564-594 (31) LDQESYEASVPISAPAGSFLLTIQPSDPISR PA
3
598-612 (15) FSLVNDSEGWLCIEK PA
3
613-645 (33) FSGEVHTAQSLQGAQPGDTYTVLVEAQDTDEPR PA
1
646-658 (13) LSASAPLVIHFLK PA
1
659-679 (21) APPAPALTLAPVPSQYLCTPR PA
1
680-691 (12) QDHGLIVSGPSK PA
2
692-714 (23) DPDLASGHGPYSFTLGPNPTVQR PA
3
718-738 (21) LQTLNGSHAYLTLALHWVEPR PA
3
739-758 (20) EHIIPVVVSHNAQMWQLLVR PA
3
764-772 (9) CNVEGQCMR PA
3
784-812 (29) LSAVGILVGTLVAIGIFLILIFTHWTMSR PA
3
815-826 (12) DPDQPADSVPLK PA
3
: Uniquely mapped peptide
: Gene-specific peptide
: Shared peptide

#424, YPRC/BPRC, Industry-University Research Center, Yonsei Univ., Seodaemun-gu, Seoul, Korea, 120-749
Tel: +82-2-2123-6626, Fax: +82-2-393-6589
2014-2019 (C) Yonsei Proteome Research Center