Home| Contact Us

HOME SEARCH STATISTICS
Peptides (NX_O75344-1)
to neXtProt Sequence Information of Isoform
Start-end (length)PeptidesCo#
2-24 (24) MGGSALNQGVLEGDDAPGQSLYER PA
1
29-36 (8) MLDISGDR PA
2
45-60 (16) EGAGDLVAPDASVLVK PA
1
61-78 (18) YSGYLEHMDRPFDSNYFR PA
1
86-103 (18) LGEDITLWGMELGLLSMR PA
1
110-150 (41) FLFKPNYAYGTLGCPPLIPPNTTVLFEIELLDFLDCAESDK PA
2
151-166 (16) FCALSAEQQDQFPLQK PA
2
176-183 (8) EFGNYLFR PA
2
205-218 (14) SAPPEEQHLVEAAK PA
2
219-231 (13) LPVLLNLSFTYLK PA
2
232-251 (20) LDRPTIALCYGEQALIIDQK PA
2
259-271 (13) CGQACLLLTEYQK PA
2
282-294 (13) EQPFNHDINNELK PA
2
314-327 (14) MFAPCGDGSTAGES PA
2
: Uniquely mapped peptide
: Gene-specific peptide
: Shared peptide

#424, YPRC/BPRC, Industry-University Research Center, Yonsei Univ., Seodaemun-gu, Seoul, Korea, 120-749
Tel: +82-2-2123-6626, Fax: +82-2-393-6589
2014-2019 (C) Yonsei Proteome Research Center