Home| Contact Us

HOME SEARCH STATISTICS
Peptides (NX_O75344-2)
to neXtProt Sequence Information of Isoform
Start-end (length)PeptidesCo#
2-19 (19) MSASSWPQNGMPPSSLYER PA
0
24-31 (8) MLDISGDR PA
2
40-55 (16) EGAGDLVAPDASVLVK PA
1
56-73 (18) YSGYLEHMDRPFDSNYFR PA
1
81-98 (18) LGEDITLWGMELGLLSMR PA
1
105-145 (41) FLFKPNYAYGTLGCPPLIPPNTTVLFEIELLDFLDCAESDK PA
2
146-161 (16) FCALSAEQQDQFPLQK PA
2
171-178 (8) EFGNYLFR PA
2
200-213 (14) SAPPEEQHLVEAAK PA
2
214-226 (13) LPVLLNLSFTYLK PA
2
227-246 (20) LDRPTIALCYGEQALIIDQK PA
2
254-266 (13) CGQACLLLTEYQK PA
2
277-289 (13) EQPFNHDINNELK PA
2
309-322 (14) MFAPCGDGSTAGES PA
2
: Uniquely mapped peptide
: Gene-specific peptide
: Shared peptide

#424, YPRC/BPRC, Industry-University Research Center, Yonsei Univ., Seodaemun-gu, Seoul, Korea, 120-749
Tel: +82-2-2123-6626, Fax: +82-2-393-6589
2014-2019 (C) Yonsei Proteome Research Center