Home| Contact Us

HOME SEARCH STATISTICS
Peptides (NX_O75344-3)
to neXtProt Sequence Information of Isoform
Start-end (length)PeptidesCo#
2-24 (24) MGGSALNQGVLEGDDAPGQSLYER PA
1
29-36 (8) MLDISGDR PA
2
45-73 (29) EGAGDLVAPDASVLDITLWGMELGLLSMR PA
0
80-120 (41) FLFKPNYAYGTLGCPPLIPPNTTVLFEIELLDFLDCAESDK PA
2
121-136 (16) FCALSAEQQDQFPLQK PA
2
146-153 (8) EFGNYLFR PA
2
175-188 (14) SAPPEEQHLVEAAK PA
2
189-201 (13) LPVLLNLSFTYLK PA
2
202-221 (20) LDRPTIALCYGEQALIIDQK PA
2
229-241 (13) CGQACLLLTEYQK PA
2
252-264 (13) EQPFNHDINNELK PA
2
284-297 (14) MFAPCGDGSTAGES PA
2
: Uniquely mapped peptide
: Gene-specific peptide
: Shared peptide

#424, YPRC/BPRC, Industry-University Research Center, Yonsei Univ., Seodaemun-gu, Seoul, Korea, 120-749
Tel: +82-2-2123-6626, Fax: +82-2-393-6589
2014-2019 (C) Yonsei Proteome Research Center