Home| Contact Us

HOME SEARCH STATISTICS
Peptides (NX_O75351-1)
to neXtProt Sequence Information of Isoform
Start-end (length)PeptidesCo#
2-10 (10) MSSTSPNLQK PA
0
24-46 (23) AGNYEEALQLYQHAVQYFLHVVK PA
0
89-98 (10) EGQPSPADEK PA
0
99-113 (15) GNDSDGEGESDDPEK PA
0
116-132 (17) LQNQLQGAIVIERPNVK PA
0
133-143 (11) WSDVAGLEGAK PA
0
148-155 (8) EAVILPIK PA
1
156-163 (8) FPHLFTGK PA
1
169-180 (12) GILLFGPPGTGK PA
3
186-207 (22) AVATEANNSTFFSISSSDLVSK PA
0
225-243 (19) ENKPSIIFIDEIDSLCGSR PA
0
244-252 (9) SENESEAAR PA
0
256-289 (34) TEFLVQMQGVGVDNDGILVLGATNIPWVLDSAIR PA
0
296-306 (11) IYIPLPEPHAR PA
0
312-327 (16) LHLGTTQNSLTEADFR PA
0
333-346 (14) TDGYSGADISIIVR PA
0
347-354 (8) DALMQPVR PA
0
356-363 (8) VQSATHFK PA
1
371-403 (33) ADPNHLVDDLLTPCSPGDPGAIEMTWMDVPGDK PA
0
404-416 (13) LLEPVVSMSDMLR PA
0
417-432 (16) SLSNTKPTVNEHDLLK PA
0
436-444 (9) FTEDFGQEG PA
0
: Uniquely mapped peptide
: Gene-specific peptide
: Shared peptide

#424, YPRC/BPRC, Industry-University Research Center, Yonsei Univ., Seodaemun-gu, Seoul, Korea, 120-749
Tel: +82-2-2123-6626, Fax: +82-2-393-6589
2014-2019 (C) Yonsei Proteome Research Center