Home| Contact Us

HOME SEARCH STATISTICS
Peptides (NX_O75367-2)
to neXtProt Sequence Information of Isoform
Start-end (length)PeptidesCo#
19-27 (9) AGVIFPVGR PA
3
41-69 (29) IGVGAPVYMAAVLEYLTAEILELAGNAAR PA
2
80-96 (17) HILLAVANDEELNQLLK PA
3
97-116 (20) GVTIASGGVLPNIHPELLAK PA
2
124-134 (11) LEAIITPPPAK PA
2
168-189 (22) AASADSTTEGTPADGFTVLSTK PA
2
197-232 (36) LQVVQADIASIDSDAVVHPTNTDFYIGGEVGNTLEK PA
0
237-246 (10) EFVEAVLELR PA
2
249-268 (20) NGPLEVAGAAVSAGHGLPAK PA
2
269-282 (14) FVIHCNSPVWGADK PA
2
293-301 (9) NCLALADDK PA
2
305-315 (11) SIAFPSIGSGR PA
2
321-329 (9) QTAAQLILK PA
2
330-344 (15) AISSYFVSTMSSSIK PA
2
345-365 (21) TVYFVLFDSESIGIYVQEMAK PA
2
: Uniquely mapped peptide
: Gene-specific peptide
: Shared peptide

#424, YPRC/BPRC, Industry-University Research Center, Yonsei Univ., Seodaemun-gu, Seoul, Korea, 120-749
Tel: +82-2-2123-6626, Fax: +82-2-393-6589
2014-2019 (C) Yonsei Proteome Research Center