Home| Contact Us

HOME SEARCH STATISTICS
Peptides (NX_O75425-1)
to neXtProt Sequence Information of Isoform
Start-end (length)PeptidesCo#
4-19 (16) GAPQDQELVGPGPPGR PA
1
23-44 (22) GAPPPLGPVVPVLVFPPDLVFR PA
1
53-66 (14) QLLTLYNPTGTALR PA
2
69-76 (8) VLCTAPAK PA
2
77-97 (21) YTVFDAEGYVKPQSCIDIVIR PA
2
98-111 (14) HVAPIPSHYDVQDR PA
2
114-124 (11) IELSEEGAEGR PA
3
137-166 (30) APAYPLELQGQPDPAPRPGPPAGTPPPTAR PA
3
174-218 (45) QQLATSSFLLFLLTGIVSVAFLLLPLPDELGSQLPQVLHVSLGQK PA
3
219-234 (16) LVAAYVLGLLTMVFLR PA
3
: Uniquely mapped peptide
: Gene-specific peptide
: Shared peptide

#424, YPRC/BPRC, Industry-University Research Center, Yonsei Univ., Seodaemun-gu, Seoul, Korea, 120-749
Tel: +82-2-2123-6626, Fax: +82-2-393-6589
2014-2019 (C) Yonsei Proteome Research Center