Home| Contact Us

HOME SEARCH STATISTICS
Peptides (NX_O75425-3)
to neXtProt Sequence Information of Isoform
Start-end (length)PeptidesCo#
2-23 (23) MTHMAGLVCVCLYPPVLCTAPAK PA
0
24-44 (21) YTVFDAEGYVKPQSCIDIVIR PA
2
45-58 (14) HVAPIPSHYDVQDR PA
2
61-71 (11) IELSEEGAEGR PA
3
84-113 (30) APAYPLELQGQPDPAPRPGPPAGTPPPTAR PA
3
121-165 (45) QQLATSSFLLFLLTGIVSVAFLLLPLPDELGSQLPQVLHVSLGQK PA
3
166-181 (16) LVAAYVLGLLTMVFLR PA
3
: Uniquely mapped peptide
: Gene-specific peptide
: Shared peptide

#424, YPRC/BPRC, Industry-University Research Center, Yonsei Univ., Seodaemun-gu, Seoul, Korea, 120-749
Tel: +82-2-2123-6626, Fax: +82-2-393-6589
2014-2019 (C) Yonsei Proteome Research Center