Home| Contact Us

HOME SEARCH STATISTICS
Peptides (NX_O75426-1)
to neXtProt Sequence Information of Isoform
Start-end (length)PeptidesCo#
17-30 (14) SCPSCGSELGVEEK PA
3
34-57 (24) GNPISIQLFPPELVEHIISFLPVR PA
3
58-67 (10) DLVALGQTCR PA
3
68-80 (13) YFHEVCDGEGVWR PA
3
90-101 (12) LQDQGSGVRPWK PA
2
103-110 (8) AAILNYTK PA
2
111-120 (10) GLYFQAFGGR PA
3
127-137 (11) SVAPLLAHGYR PA
3
144-159 (16) DHVFILDYVGTLFFLK PA
3
160-172 (13) NALVSTLGQMQWK PA
3
200-207 (8) YLYVLATR PA
3
208-219 (12) EPQEVVGTTSSR PA
3
220-234 (15) ACDCVEVYLQSSGQR PA
3
238-247 (10) MTFHHSMTFK PA
3
248-258 (11) QIVLVGQETQR PA
3
259-268 (10) ALLLLTEEGK PA
3
269-283 (15) IYSLVVNETQLDQPR PA
3
284-292 (9) SYTVQLALR PA
3
294-302 (9) VSHYLPHLR PA
3
303-333 (31) VACMTSNQSSTLYVTDQGGVYFEVHTPGVYR PA
2
334-358 (25) DLFGTLQAFDPLDQQMPLALSLPAK PA
2
359-377 (19) ILFCALGYNHLGLVDEFGR PA
2
378-385 (8) IFMQGNNR PA
2
386-394 (9) YGQLGTGDK PA
2
398-430 (33) GEPTQVCYLQRPITLWCGLNHSLVLSQSSEFSK PA
2
431-442 (12) ELLGCGCGAGGR PA
2
460-471 (12) VPLCACALCATR PA
2
472-489 (18) ECLYILSSHDIEQHAPYR PA
2
496-507 (12) VVGTPEPSLGAR PA
2
508-535 (28) APQDPGGMAQACEEYLSQIHSCQTLQDR PA
2
541-553 (13) EIVGWMPLMAAQK PA
2
554-565 (12) DFFWEALDMLQR PA
2
566-580 (15) AEGGGGGVGPPAPET PA
2
: Uniquely mapped peptide
: Gene-specific peptide
: Shared peptide

#424, YPRC/BPRC, Industry-University Research Center, Yonsei Univ., Seodaemun-gu, Seoul, Korea, 120-749
Tel: +82-2-2123-6626, Fax: +82-2-393-6589
2014-2019 (C) Yonsei Proteome Research Center