Home| Contact Us

HOME SEARCH STATISTICS
Peptides (NX_O75426-2)
to neXtProt Sequence Information of Isoform
Start-end (length)PeptidesCo#
17-30 (14) SCPSCGSELGVEEK PA
3
34-57 (24) GNPISIQLFPPELVEHIISFLPVR PA
3
58-67 (10) DLVALGQTCR PA
3
68-80 (13) YFHEVCDGEGVWR PA
3
97-106 (10) GLYFQAFGGR PA
3
113-123 (11) SVAPLLAHGYR PA
3
130-145 (16) DHVFILDYVGTLFFLK PA
3
146-158 (13) NALVSTLGQMQWK PA
3
186-193 (8) YLYVLATR PA
3
194-205 (12) EPQEVVGTTSSR PA
3
206-220 (15) ACDCVEVYLQSSGQR PA
3
224-233 (10) MTFHHSMTFK PA
3
234-244 (11) QIVLVGQETQR PA
3
245-254 (10) ALLLLTEEGK PA
3
255-269 (15) IYSLVVNETQLDQPR PA
3
270-278 (9) SYTVQLALR PA
3
280-288 (9) VSHYLPHLR PA
3
289-318 (30) VACMTSNQSSTLYVTDPILCSWLQPPWPGG PA
0
: Uniquely mapped peptide
: Gene-specific peptide
: Shared peptide

#424, YPRC/BPRC, Industry-University Research Center, Yonsei Univ., Seodaemun-gu, Seoul, Korea, 120-749
Tel: +82-2-2123-6626, Fax: +82-2-393-6589
2014-2019 (C) Yonsei Proteome Research Center