Home| Contact Us

HOME SEARCH STATISTICS
Peptides (NX_O75426-3)
to neXtProt Sequence Information of Isoform
Start-end (length)PeptidesCo#
2-9 (9) MVWESQQER PA
0
55-68 (14) SCPSCGSELGVEEK PA
3
72-95 (24) GNPISIQLFPPELVEHIISFLPVR PA
3
96-105 (10) DLVALGQTCR PA
3
106-118 (13) YFHEVCDGEGVWR PA
3
128-139 (12) LQDQGSGVRPWK PA
2
141-148 (8) AAILNYTK PA
2
149-158 (10) GLYFQAFGGR PA
3
165-175 (11) SVAPLLAHGYR PA
3
182-197 (16) DHVFILDYVGTLFFLK PA
3
198-210 (13) NALVSTLGQMQWK PA
3
238-245 (8) YLYVLATR PA
3
246-257 (12) EPQEVVGTTSSR PA
3
258-272 (15) ACDCVEVYLQSSGQR PA
3
276-285 (10) MTFHHSMTFK PA
3
286-296 (11) QIVLVGQETQR PA
3
297-306 (10) ALLLLTEEGK PA
3
307-321 (15) IYSLVVNETQLDQPR PA
3
322-330 (9) SYTVQLALR PA
3
332-340 (9) VSHYLPHLR PA
3
341-371 (31) VACMTSNQSSTLYVTDQGGVYFEVHTPGVYR PA
2
372-396 (25) DLFGTLQAFDPLDQQMPLALSLPAK PA
2
397-415 (19) ILFCALGYNHLGLVDEFGR PA
2
416-423 (8) IFMQGNNR PA
2
424-432 (9) YGQLGTGDK PA
2
436-468 (33) GEPTQVCYLQRPITLWCGLNHSLVLSQSSEFSK PA
2
469-480 (12) ELLGCGCGAGGR PA
2
498-509 (12) VPLCACALCATR PA
2
510-527 (18) ECLYILSSHDIEQHAPYR PA
2
534-545 (12) VVGTPEPSLGAR PA
2
546-573 (28) APQDPGGMAQACEEYLSQIHSCQTLQDR PA
2
579-591 (13) EIVGWMPLMAAQK PA
2
592-603 (12) DFFWEALDMLQR PA
2
604-618 (15) AEGGGGGVGPPAPET PA
2
: Uniquely mapped peptide
: Gene-specific peptide
: Shared peptide

#424, YPRC/BPRC, Industry-University Research Center, Yonsei Univ., Seodaemun-gu, Seoul, Korea, 120-749
Tel: +82-2-2123-6626, Fax: +82-2-393-6589
2014-2019 (C) Yonsei Proteome Research Center