Home| Contact Us

HOME SEARCH STATISTICS
Peptides (NX_O75426-4)
to neXtProt Sequence Information of Isoform
Start-end (length)PeptidesCo#
5-18 (14) SCPSCGSELGVEEK PA
3
22-45 (24) GNPISIQLFPPELVEHIISFLPVR PA
3
46-55 (10) DLVALGQTCR PA
3
56-68 (13) YFHEVCDGEGVWR PA
3
78-89 (12) LQDQGSGVRPWK PA
2
91-98 (8) AAILNYTK PA
2
99-108 (10) GLYFQAFGGR PA
3
115-125 (11) SVAPLLAHGYR PA
3
132-147 (16) DHVFILDYVGTLFFLK PA
3
148-160 (13) NALVSTLGQMQWK PA
3
188-195 (8) YLYVLATR PA
3
196-207 (12) EPQEVVGTTSSR PA
3
208-222 (15) ACDCVEVYLQSSGQR PA
3
226-235 (10) MTFHHSMTFK PA
3
236-246 (11) QIVLVGQETQR PA
3
247-256 (10) ALLLLTEEGK PA
3
257-271 (15) IYSLVVNETQLDQPR PA
3
272-280 (9) SYTVQLALR PA
3
282-290 (9) VSHYLPHLR PA
3
291-321 (31) VACMTSNQSSTLYVTDQGGVYFEVHTPGVYR PA
2
322-346 (25) DLFGTLQAFDPLDQQMPLALSLPAK PA
2
347-365 (19) ILFCALGYNHLGLVDEFGR PA
2
366-373 (8) IFMQGNNR PA
2
374-382 (9) YGQLGTGDK PA
2
386-418 (33) GEPTQVCYLQRPITLWCGLNHSLVLSQSSEFSK PA
2
419-430 (12) ELLGCGCGAGGR PA
2
448-459 (12) VPLCACALCATR PA
2
460-477 (18) ECLYILSSHDIEQHAPYR PA
2
484-495 (12) VVGTPEPSLGAR PA
2
496-523 (28) APQDPGGMAQACEEYLSQIHSCQTLQDR PA
2
529-541 (13) EIVGWMPLMAAQK PA
2
542-553 (12) DFFWEALDMLQR PA
2
554-568 (15) AEGGGGGVGPPAPET PA
2
: Uniquely mapped peptide
: Gene-specific peptide
: Shared peptide

#424, YPRC/BPRC, Industry-University Research Center, Yonsei Univ., Seodaemun-gu, Seoul, Korea, 120-749
Tel: +82-2-2123-6626, Fax: +82-2-393-6589
2014-2019 (C) Yonsei Proteome Research Center