Home| Contact Us

HOME SEARCH STATISTICS
Peptides (NX_O75427-1)
to neXtProt Sequence Information of Isoform
Start-end (length)PeptidesCo#
2-31 (31) MAAAVAAPLAAGGEEAAATTSVPGSPGLPGR PA
0
37-52 (16) ALEEAVATGTLNLSNR PA
0
64-77 (14) SYDLSDITQADLSR PA
0
80-104 (25) FPEVPEAACQLVSLEGLSLYHNCLR PA
0
105-123 (19) CLNPALGNLTALTYLNLSR PA
0
124-139 (16) NQLSLLPPYICQLPLR PA
0
140-147 (8) VLIVSNNK PA
0
148-162 (15) LGALPPDIGTLGSLR PA
0
163-185 (23) QLDVSSNELQSLPSELCGLSSLR PA
0
192-208 (17) NQLSTLPEELGDLPLVR PA
0
228-249 (22) HLQVILLDSNPLQSPPAQVCLK PA
0
257-265 (9) YLSTEAGQR PA
0
266-293 (28) GSALGDLAPSRPPSFSPCPAEDLFPGHR PA
0
294-310 (17) YDGGLDSGFHSVDSGSK PA
0
312-327 (16) WSGNESTDEFSELSFR PA
0
343-368 (26) EDGSADGDPVQIDFIDSHVPGEDEER PA
0
369-386 (18) GTVEEQRPPELSPGAGDR PA
0
395-402 (8) EEPAGEER PA
0
404-414 (11) RPDTLQLWQER PA
0
418-429 (12) QQQQSGAWGAPR PA
0
431-439 (9) DSLLKPGLR PA
0
440-459 (20) AVVGGAAAVSTQAMHNGSPK PA
0
460-510 (51) SSASQAGAAAGQGAPAPAPASQEPLPIAGPATAPAPRPLGSIQRPNSFLFR PA
0
511-529 (19) SSSQSGSGPSSPDSVLRPR PA
0
531-538 (8) YPQVPDEK PA
0
552-580 (29) LQRPLPEDLAEALASGVILCQLANQLRPR PA
0
581-594 (14) SVPFIHVPSPAVPK PA
0
603-612 (10) NVESFLEACR PA
0
614-633 (20) MGVPEADLCSPSDLLQGTAR PA
0
649-679 (31) ALPPLWPPSGLGGFVVFYVVLMLLLYVTYTR PA
0
: Uniquely mapped peptide
: Gene-specific peptide
: Shared peptide

#424, YPRC/BPRC, Industry-University Research Center, Yonsei Univ., Seodaemun-gu, Seoul, Korea, 120-749
Tel: +82-2-2123-6626, Fax: +82-2-393-6589
2014-2019 (C) Yonsei Proteome Research Center