Home| Contact Us

HOME SEARCH STATISTICS
Peptides (NX_O75439-1)
to neXtProt Sequence Information of Isoform
Start-end (length)PeptidesCo#
8-15 (8) VVLSSAAR PA
0
18-28 (11) LWGFSESLLIR PA
0
34-41 (8) SLYFGENR PA
0
44-59 (16) STQAATQVVLNVPETR PA
0
60-68 (9) VTCLESGLR PA
0
69-90 (22) VASEDSGLSTCTVGLWIDAGSR PA
0
96-109 (14) NNGTAHFLEHMAFK PA
0
115-136 (22) SQLDLELEIENMGAHLNAYTSR PA
0
137-144 (8) EQTVYYAK PA
0
153-173 (21) AVEILADIIQNSTLGEAEIER PA
0
181-209 (29) EMQEVETNLQEVVFDYLHATAYQNTALGR PA
0
210-219 (10) TILGPTENIK PA
0
225-235 (11) DLVDYITTHYK PA
0
239-257 (19) IVLAAAGGVSHDELLDLAK PA
0
258-268 (11) FHFGDSLCTHK PA
0
269-278 (10) GEIPALPPCK PA
0
291-325 (35) MPLAHLAIAVEAVGWAHPDTICLMVANTLIGNWDR PA
0
326-336 (11) SFGGGMNLSSK PA
0
337-383 (47) LAQLTCHGNLCHSFQSFNTSYTDTGLWGLYMVCESSTVADMLHVVQK PA
0
388-399 (12) LCTSVTESEVAR PA
0
406-424 (19) TNMLLQLDGSTPICEDIGR PA
0
433-441 (9) IPIPELEAR PA
0
442-451 (10) IDAVNAETIR PA
0
462-472 (11) SPAIAAVGPIK PA
0
: Uniquely mapped peptide
: Gene-specific peptide
: Shared peptide

#424, YPRC/BPRC, Industry-University Research Center, Yonsei Univ., Seodaemun-gu, Seoul, Korea, 120-749
Tel: +82-2-2123-6626, Fax: +82-2-393-6589
2014-2019 (C) Yonsei Proteome Research Center