Home| Contact Us

HOME SEARCH STATISTICS
Peptides (NX_O75553-1)
to neXtProt Sequence Information of Isoform
Start-end (length)PeptidesCo#
2-12 (12) MSTETELQVAVK PA
5
46-56 (11) LIGIDEVSAAR PA
5
60-67 (8) LCQDSMMK PA
5
85-95 (11) IFLTISFGGIK PA
5
101-118 (18) TGALQHHHAVHEISYIAK PA
4
125-132 (8) AFGYVCGK PA
4
143-155 (13) TAQAAEPVILDLR PA
4
156-165 (10) DLFQLIYELK PA
4
179-211 (33) QCEQAVYQTILEEDVEDPVYQYIVFEAGHEPIR PA
1
212-227 (16) DPETEENIYQVPTSQK PA
1
229-236 (8) EGVYDVPK PA
4
237-252 (16) SQPVSNGYSFEDFEER PA
3
253-260 (8) FAAATPNR PA
2
261-274 (14) NLPTDFDEIFEATK PA
2
275-431 (157) AVTQLELFGDMSTPPDITSPPTPATPGDAFIPSSSQTLPASADVFSSVPFGTAAVPSGYVAMGAVLPSFWGQQPLVQQQM
VMGAQPPVAQVMPGAQPIAWGQPGLFPATQQPWPTVAGQFPPAAFMPTQTVMPLPAAMFQGPLTPLATVPGTSDSTR PA
2
432-440 (9) SSPQTDKPR PA
4
450-462 (13) DFQMAQPPPVPSR PA
4
463-482 (20) KPDQPSLTCTSEAFSSYFNK PA
4
483-521 (39) VGVAQDTDDCDDFDISQLNLTPVTSTTPSTNSPPTPAPR PA
4
528-551 (24) SSASHASDPTTDDIFEEGFESPSK PA
4
552-588 (37) SEEQEAPDGSQASSNSDPFGEPSGEPSGDNISPQAGS PA
4
: Uniquely mapped peptide
: Gene-specific peptide
: Shared peptide

#424, YPRC/BPRC, Industry-University Research Center, Yonsei Univ., Seodaemun-gu, Seoul, Korea, 120-749
Tel: +82-2-2123-6626, Fax: +82-2-393-6589
2014-2019 (C) Yonsei Proteome Research Center