Home| Contact Us

HOME SEARCH STATISTICS
Peptides (NX_O75553-4)
to neXtProt Sequence Information of Isoform
Start-end (length)PeptidesCo#
2-12 (12) MSTETELQVAVK PA
5
46-56 (11) LIGIDEVSAAR PA
5
60-67 (8) LCQDSMMK PA
5
85-95 (11) IFLTISFGGIK PA
5
101-118 (18) TGALQHHHAVHEISYIAK PA
4
125-132 (8) AFGYVCGK PA
4
143-155 (13) TAQAAEPVILDLR PA
4
156-165 (10) DLFQLIYELK PA
4
179-192 (14) QCEQAVYQVPTSQK PA
1
194-201 (8) EGVYDVPK PA
4
202-217 (16) SQPVSNGYSFEDFEER PA
3
218-380 (163) FAAATPAVTQLELFGDMSTPPDITSPPTPATPGDAFIPSSSQTLPASADVFSSVPFGTAAVPSGYVAMGAVLPSFWGQQPLVQQQMVMGAQPPVAQVMPGAQPIAWGQPGLFPATQQPWPTVAGQFPPAAFMPTQTVMPLPAAMFQGPLTPLATVPGTSDSTR PA
0
381-389 (9) SSPQTDKPR PA
4
399-411 (13) DFQMAQPPPVPSR PA
4
412-431 (20) KPDQPSLTCTSEAFSSYFNK PA
4
432-470 (39) VGVAQDTDDCDDFDISQLNLTPVTSTTPSTNSPPTPAPR PA
4
477-500 (24) SSASHASDPTTDDIFEEGFESPSK PA
4
501-537 (37) SEEQEAPDGSQASSNSDPFGEPSGEPSGDNISPQAGS PA
4
: Uniquely mapped peptide
: Gene-specific peptide
: Shared peptide

#424, YPRC/BPRC, Industry-University Research Center, Yonsei Univ., Seodaemun-gu, Seoul, Korea, 120-749
Tel: +82-2-2123-6626, Fax: +82-2-393-6589
2014-2019 (C) Yonsei Proteome Research Center