Home| Contact Us

HOME SEARCH STATISTICS
Peptides (NX_O75678-1)
to neXtProt Sequence Information of Isoform
Start-end (length)PeptidesCo#
2-17 (17) MEVAELGFPETAVSQSR PA
0
18-37 (20) ICLCAVLCGHWDFADMMVIR PA
0
51-61 (11) DPVGGGNLTNK PA
0
62-77 (16) RPSCAPSPQDLSAQWK PA
0
89-123 (35) VDMAALFQEASSCPVCSDYLEKPMSLECGCAVCLK PA
0
131-147 (17) EPHGEDLLCCCSSMVSR PA
2
184-206 (23) FQVDMTLDANTANNFLLISDDLR PA
2
224-235 (12) FDVSVCILGSPR PA
4
241-259 (19) HCWEVDVGTSTEWDLGVCR PA
2
268-282 (15) IQLTTELGFWTVSLR PA
4
287-301 (15) LSATTVPLTFLFVDR PA
2
306-332 (27) VGIFLDMGMQNVSFFDAESGSHVYTFR PA
4
333-378 (46) SVSAEEPLRPFLAPSVPPNGDQGVLSICPLMNSGTTDAPVRPGEAK PA
2
: Uniquely mapped peptide
: Gene-specific peptide
: Shared peptide

#424, YPRC/BPRC, Industry-University Research Center, Yonsei Univ., Seodaemun-gu, Seoul, Korea, 120-749
Tel: +82-2-2123-6626, Fax: +82-2-393-6589
2014-2019 (C) Yonsei Proteome Research Center