Home| Contact Us

HOME SEARCH STATISTICS
Peptides (NX_O75679-1)
to neXtProt Sequence Information of Isoform
Start-end (length)PeptidesCo#
4-11 (8) LSLVTTNR PA
2
12-62 (51) LSPQGNFLPLCTFPLAVDMAALFQEASSCPVCSDYLEKPMSLECGCTVCLK PA
0
70-87 (18) EPHGEDLLCCCCSMVSQR PA
1
123-145 (23) FQVDMTLDADTANNFLLISDDLR PA
2
149-156 (8) SGLITQNR PA
1
163-174 (12) FDVSVCILGSPR PA
4
180-198 (19) HYWEVDVGTSTEWDLGVCR PA
2
207-221 (15) IQLTTELGFWTVSLR PA
4
226-240 (15) LSASTVPLTFLLVDR PA
1
245-271 (27) VGIFLDMGMQNVSFFDAESGSHVYTFR PA
4
272-317 (46) SVSAEEPLRPFLAPSIPPNGDQGVLSICPLMNSGTTDAPVRPGEAK PA
1
: Uniquely mapped peptide
: Gene-specific peptide
: Shared peptide

#424, YPRC/BPRC, Industry-University Research Center, Yonsei Univ., Seodaemun-gu, Seoul, Korea, 120-749
Tel: +82-2-2123-6626, Fax: +82-2-393-6589
2014-2019 (C) Yonsei Proteome Research Center