Home| Contact Us

HOME SEARCH STATISTICS
Peptides (NX_O75808-1)
to neXtProt Sequence Information of Isoform
Start-end (length)PeptidesCo#
2-11 (11) MATVGEWSCVR PA
1
12-21 (10) CTFLNPAGQR PA
1
22-30 (9) QCSICEAPR PA
1
31-40 (10) HKPDLNHILR PA
1
62-98 (37) EACEVCGFTPEPAPGAAFLPVLNGVLPKPPAILGEPK PA
1
99-109 (11) GSCQEEAGPVR PA
1
110-120 (11) TAGLVATEPAR PA
1
132-144 (13) EEQEEEEGAAEPR PA
1
152-170 (19) CTLHNTPVASSCSVCGGPR PA
1
177-228 (52) IPPEALVVPEVVAPAGFHVVPAAPPPGLPGEGAEANPPATSQGPAAEPEPPR PA
1
229-246 (18) VPPFSPFSSTLQNNPVPR PA
1
250-272 (23) EVPPQLQPPVPEAAQPSPSAGCR PA
1
273-285 (13) GAPQGSGWAGASR PA
1
286-293 (8) LAELLSGK PA
1
295-309 (15) LSVLEEEATEGGTSR PA
1
310-330 (21) VEAGSSTSGSDIIDLAGDTVR PA
1
331-348 (18) YTPASPSSPDFTTWSCAK PA
1
360-367 (8) CSACGCSK PA
0
368-394 (27) LHGFQEHGEPPTHCPDCGADKPSPCGR PA
0
408-428 (21) VLPERPGQWACPACTLLNALR PA
0
431-445 (15) HCAACHTPQLLVAQR PA
0
455-462 (8) ESMHVEQR PA
0
464-471 (8) QTDEGEAK PA
0
472-482 (11) ALWENIVAFCR PA
0
483-511 (29) ENNVSFVDDSFPPGPESVGFPAGDSVQQR PA
0
514-527 (14) QWLRPQEINCSVFR PA
0
531-570 (40) ATWSVFHTLRPSDILQGLLGNCWFLSALAVLAERPDLVER PA
0
576-586 (11) SLCAEGAYQVR PA
0
590-617 (28) DGTWTTVLVDDMLPCDEAGCLLFSQAQR PA
0
619-627 (9) QLWVALIEK PA
0
632-643 (12) LHGSYFALQAGR PA
0
644-669 (26) AIEGLATLTGAPCESLALQLSSTNPR PA
0
670-681 (12) EEPVDTDLIWAK PA
0
687-702 (16) EAGFLMGASCGGGNMK PA
0
703-716 (14) VDDSAYESLGLRPR PA
0
717-725 (9) HAYSILDVR PA
0
742-760 (19) FSWNGSWSDEWPHWPGHLR PA
0
761-782 (22) GELMPHGSSEGVFWMEYGDFVR PA
0
783-791 (9) YFDSVDICK PA
0
792-800 (9) VHSDWQEAR PA
0
801-823 (23) VQGCFPSSASAPVGVTALTVLER PA
0
824-836 (13) ASLEFALFQEGSR PA
0
838-854 (17) SDAVDSHLLDLCILVFR PA
0
855-867 (13) ATFGSGGHLSLGR PA
0
879-922 (44) FVSCDVMLEPGEYAVVCCAFNHWGPPLPGTPAPQASSPSAGVPR PA
0
923-938 (16) ASPEPPGHVLAVYSSR PA
0
939-963 (25) LVMVEPVEAQPTTLADAIILLTESR PA
0
971-992 (22) EGMTCYYLTHGWAGLIVVVENR PA
0
996-1014 (19) AYLHVQCDCTDSFNVVSTR PA
0
1019-1028 (10) TQDSVPPLHR PA
0
1029-1048 (20) QVLVILSQLEGNAGFSITHR PA
0
1054-1066 (13) AAQAFLSDWTASK PA
0
1067-1086 (20) GTHSPPLTPEVAGLHGPRPL PA
0
: Uniquely mapped peptide
: Gene-specific peptide
: Shared peptide

#424, YPRC/BPRC, Industry-University Research Center, Yonsei Univ., Seodaemun-gu, Seoul, Korea, 120-749
Tel: +82-2-2123-6626, Fax: +82-2-393-6589
2014-2019 (C) Yonsei Proteome Research Center