Home| Contact Us

HOME SEARCH STATISTICS
Peptides (NX_O75871-1)
to neXtProt Sequence Information of Isoform
Start-end (length)PeptidesCo#
2-9 (9) MGPPSAAPR PA
0
10-49 (40) GGHRPWQGLLITASLLTFWHPPTTVQFTIEALPSSAAEGK PA
0
50-69 (20) DVLLLACNISETIQAYYWHK PA
0
72-98 (27) TAEGSPLIAGYITDIQANIPGAAYSGR PA
0
99-123 (25) ETVYPNGSLLFQNITLEDAGSYTLR PA
0
124-178 (55) TINASYDSDQATGQLHVHQNNVPGLPVGAVAGIVTGVLVGVALVAALVCFLLLSR PA
0
190-205 (16) EQPPPASTPGHGPSHR PA
0
206-216 (11) STFSAPLPSPR PA
0
217-239 (23) TATPIYEELLYSDANIYCQIDHK PA
0
: Uniquely mapped peptide
: Gene-specific peptide
: Shared peptide

#424, YPRC/BPRC, Industry-University Research Center, Yonsei Univ., Seodaemun-gu, Seoul, Korea, 120-749
Tel: +82-2-2123-6626, Fax: +82-2-393-6589
2014-2019 (C) Yonsei Proteome Research Center