Home| Contact Us

HOME SEARCH STATISTICS
Peptides (NX_O75901-1)
to neXtProt Sequence Information of Isoform
Start-end (length)PeptidesCo#
28-38 (11) EIVVWVCQEEK PA
0
47-67 (21) TTSADVIQALLEEHEATFGEK PA
0
69-82 (14) FLLGKPSDYCIIEK PA
0
102-116 (15) AWGDEQPNMQFVLVK PA
0
117-127 (11) ADAFLPVPLWR PA
0
140-150 (11) LWELSPANYMK PA
0
173-180 (8) QDTVSHDR PA
0
181-202 (22) DNMETLVHLIISQDHTIHQQVK PA
0
206-213 (8) ELDLEIEK PA
0
223-272 (50) VENDGENYVQDAYLMPSFSEVEQNLDLQYEENQTLEDLSESDGIEQLEER PA
0
293-319 (27) SVCIDINEDAEGEAASELESSNLESVK PA
0
332-341 (10) IHSHLSGIQK PA
0
345-353 (9) YSDSLLQMK PA
0
363-372 (10) EFNSLHISNK PA
0
384-400 (17) ESEVPSSNGEIPPFTQR PA
0
401-435 (35) VFSNYTNDTDSDTGISSNHSQDSETTVGDVVLLST PA
0
: Uniquely mapped peptide
: Gene-specific peptide
: Shared peptide

#424, YPRC/BPRC, Industry-University Research Center, Yonsei Univ., Seodaemun-gu, Seoul, Korea, 120-749
Tel: +82-2-2123-6626, Fax: +82-2-393-6589
2014-2019 (C) Yonsei Proteome Research Center