Home| Contact Us

HOME SEARCH STATISTICS
Peptides (NX_O76015-1)
to neXtProt Sequence Information of Isoform
Start-end (length)PeptidesCo#
2-21 (21) MTSSYSSSSCPLGCTMAPGAR PA
0
22-54 (33) NVSVSPIDIGCQPGAEANIAPMCLLANVAHANR PA
0
57-105 (49) VGSTPLGRPSLCLPPTCHTACPLPGTCHIPGNIGICGAYGENTLNGHEK PA
0
106-114 (9) ETMQFLNDR PA
8
124-139 (16) QLEQENAELEATLLER PA
0
142-164 (23) CHESTVCPDYQSYFHTIEELQQK PA
0
175-183 (9) LIVQIDNAK PA
1
213-221 (9) LLDDATLAK PA
1
222-232 (11) ADLEAQQESLK PA
1
240-247 (8) SNHEQEVK PA
1
259-271 (13) IELDIEPTIDLNR PA
1
278-288 (11) AQYEAMLETNR PA
0
289-324 (36) QDVEQWFQAQSEGISLQDMSCSEELQCCQSEILELR PA
0
325-334 (10) CTVNALEVER PA
1
342-354 (13) DCLQNSLCEAEDR PA
1
355-377 (23) FGTELAQMQSLISNVEEQLSEIR PA
0
383-394 (12) QNQEYQVLLDVK PA
4
397-405 (9) LENEIATYR PA
1
406-414 (9) NLLESEDCK PA
1
415-455 (41) LPCNPCSTSPSCVTAPCAPRPSCGPCTTCGPTCGASTTGSR PA
0
: Uniquely mapped peptide
: Gene-specific peptide
: Shared peptide

#424, YPRC/BPRC, Industry-University Research Center, Yonsei Univ., Seodaemun-gu, Seoul, Korea, 120-749
Tel: +82-2-2123-6626, Fax: +82-2-393-6589
2014-2019 (C) Yonsei Proteome Research Center