Home| Contact Us

HOME SEARCH STATISTICS
Peptides (NX_O94818-2)
to neXtProt Sequence Information of Isoform
Start-end (length)PeptidesCo#
10-17 (8) QFQDWCLR PA
1
36-52 (17) IVQLLNGSESSSTDNAK PA
1
61-71 (11) GFQLGQPDEVR PA
1
79-86 (8) QVLYVPVK PA
1
87-96 (10) TTDGVGVDEK PA
1
102-127 (26) VAVVEDFFDIIYSMHVETGPNGEQIR PA
2
138-148 (11) AISESYAFLPR PA
2
154-163 (10) FLMSCSECQK PA
2
165-175 (11) MHLNPDGTDHK PA
2
176-200 (25) DNGKPPTLVTSMIDYNMPITMAYMK PA
2
204-230 (27) LQLLNSQQDEDESSIESDEFDMSDSTR PA
2
231-245 (15) MSAVNSDLSSNLEER PA
2
246-284 (39) MQSPQNLHGQQDDDSAAESFNGNETLGHSSIASGGTHSR PA
2
285-294 (10) EMGDSNSDGK PA
2
295-320 (26) TGLEQDEQPLNLSDSPLSAQLTSEYR PA
3
321-329 (9) IDDHNSNGK PA
3
334-341 (8) NLLISDLK PA
3
353-365 (13) SPAHSYSSYDSGK PA
3
372-380 (9) GAEDLSLNR PA
3
381-396 (16) GDEDEDDHEDHDDSEK PA
3
397-407 (11) VNETDGVEAER PA
3
410-420 (11) AFNDESAPADK PA
0
421-457 (37) QCKPEATQATYSTSAVPGSQDVLYINGNGTYSYHSYR PA
3
458-480 (23) GLGGGLLNLNDASSSGPTDLSMK PA
3
482-508 (27) QLATSSGSSSSSNSRPQLSPTEINAVR PA
3
516-523 (8) ESAAFLLR PA
4
524-536 (13) SADELENLILQQN PA
4
: Uniquely mapped peptide
: Gene-specific peptide
: Shared peptide

#424, YPRC/BPRC, Industry-University Research Center, Yonsei Univ., Seodaemun-gu, Seoul, Korea, 120-749
Tel: +82-2-2123-6626, Fax: +82-2-393-6589
2014-2019 (C) Yonsei Proteome Research Center