Home| Contact Us

HOME SEARCH STATISTICS
Peptides (NX_O94818-3)
to neXtProt Sequence Information of Isoform
Start-end (length)PeptidesCo#
2-22 (22) MADLMQETFLHHATDGVGVDEK PA
0
28-53 (26) VAVVEDFFDIIYSMHVETGPNGEQIR PA
2
64-74 (11) AISESYAFLPR PA
2
80-89 (10) FLMSCSECQK PA
2
91-101 (11) MHLNPDGTDHK PA
2
102-126 (25) DNGKPPTLVTSMIDYNMPITMAYMK PA
2
130-156 (27) LQLLNSQQDEDESSIESDEFDMSDSTR PA
2
157-171 (15) MSAVNSDLSSNLEER PA
2
172-210 (39) MQSPQNLHGQQDDDSAAESFNGNETLGHSSIASGGTHSR PA
2
211-220 (10) EMGDSNSDGK PA
2
221-246 (26) TGLEQDEQPLNLSDSPLSAQLTSEYR PA
3
247-255 (9) IDDHNSNGK PA
3
260-267 (8) NLLISDLK PA
3
279-291 (13) SPAHSYSSYDSGK PA
3
298-306 (9) GAEDLSLNR PA
3
307-322 (16) GDEDEDDHEDHDDSEK PA
3
323-333 (11) VNETDGVEAER PA
3
343-351 (9) LFVDENLDR PA
4
363-371 (9) IQAIIDSCR PA
2
373-380 (8) QFPEYQER PA
2
398-428 (31) SGFEMSRPIPSHLTSAVAESILASACESESR PA
2
439-448 (10) QQDESAPADK PA
2
449-485 (37) QCKPEATQATYSTSAVPGSQDVLYINGNGTYSYHSYR PA
3
486-508 (23) GLGGGLLNLNDASSSGPTDLSMK PA
3
510-536 (27) QLATSSGSSSSSNSRPQLSPTEINAVR PA
3
544-551 (8) ESAAFLLR PA
4
552-564 (13) SADELENLILQQN PA
4
: Uniquely mapped peptide
: Gene-specific peptide
: Shared peptide

#424, YPRC/BPRC, Industry-University Research Center, Yonsei Univ., Seodaemun-gu, Seoul, Korea, 120-749
Tel: +82-2-2123-6626, Fax: +82-2-393-6589
2014-2019 (C) Yonsei Proteome Research Center