Home| Contact Us

HOME SEARCH STATISTICS
Peptides (NX_O94818-4)
to neXtProt Sequence Information of Isoform
Start-end (length)PeptidesCo#
2-9 (9) MGDSNSDGK PA
0
10-35 (26) TGLEQDEQPLNLSDSPLSAQLTSEYR PA
3
36-44 (9) IDDHNSNGK PA
3
49-56 (8) NLLISDLK PA
3
68-80 (13) SPAHSYSSYDSGK PA
3
87-95 (9) GAEDLSLNR PA
3
96-111 (16) GDEDEDDHEDHDDSEK PA
3
112-122 (11) VNETDGVEAER PA
3
132-140 (9) LFVDENLDR PA
4
152-160 (9) IQAIIDSCR PA
2
162-169 (8) QFPEYQER PA
2
187-217 (31) SGFEMSRPIPSHLTSAVAESILASACESESR PA
2
228-237 (10) QQDESAPADK PA
2
238-274 (37) QCKPEATQATYSTSAVPGSQDVLYINGNGTYSYHSYR PA
3
275-297 (23) GLGGGLLNLNDASSSGPTDLSMK PA
3
299-325 (27) QLATSSGSSSSSNSRPQLSPTEINAVR PA
3
333-340 (8) ESAAFLLR PA
4
341-353 (13) SADELENLILQQN PA
4
: Uniquely mapped peptide
: Gene-specific peptide
: Shared peptide

#424, YPRC/BPRC, Industry-University Research Center, Yonsei Univ., Seodaemun-gu, Seoul, Korea, 120-749
Tel: +82-2-2123-6626, Fax: +82-2-393-6589
2014-2019 (C) Yonsei Proteome Research Center