Home| Contact Us

HOME SEARCH STATISTICS
Peptides (NX_O94875-3)
to neXtProt Sequence Information of Isoform
Start-end (length)PeptidesCo#
2-56 (56) MSYYQRPFSPSAYSLPASLNSSIVMQHGTSLDSTDTYPQHAQSLDGTTSSSIPLYR PA
1
69-88 (20) APHYPGIGPVDESGIPTAIR PA
9
104-142 (39) QIHMVHKPDDDTDMYNTPYTYNAGLYNPPYSAQSHPAAK PA
9
143-151 (9) TQTYRPLSK PA
11
152-162 (11) SHSDNSPNAFK PA
11
163-183 (21) DASSPVPPPHVPPPVPPLRPR PA
11
191-198 (8) HDWDPPDR PA
11
211-219 (9) SIFEYEPGK PA
11
220-240 (21) SSILQHERPPPLPTTPTPVPR PA
4
252-264 (13) LGEVTGSPSPPPR PA
4
265-273 (9) SGAPTPSSR PA
4
274-284 (11) APALSPTRPPK PA
4
285-310 (26) KPLDYVQDHSSGVFNEASLYQSSIDR PA
6
311-326 (16) SLERPMSSASMASDFR PA
10
331-339 (9) SEPAVGPPR PA
10
340-348 (9) GLGDQSASR PA
10
354-365 (12) VDLPGSSTTLTK PA
10
366-377 (12) SFTSSSPSSPSR PA
10
386-396 (11) SYSSTLTDMGR PA
10
432-439 (8) GDTVYILR PA
10
441-453 (13) IDQNWYEGEHHGR PA
10
454-464 (11) VGIFPISYVEK PA
10
471-491 (21) AQPARPPPPAQPGEIGEAIAK PA
10
492-505 (14) YNFNADTNVELSLR PA
10
516-524 (9) VDQNWYEGK PA
10
531-543 (13) QGIFPVSYVEVVK PA
10
548-565 (18) GAEDYPDPPIPHSYSSDR PA
10
566-600 (35) IHSLSSNKPQRPVFTHENIQGGGEPFQALYNYTPR PA
9
601-608 (8) NEDELELR PA
9
609-618 (10) ESDVIDVMEK PA
9
619-629 (11) CDDGWFVGTSR PA
20
633-643 (11) FFGTFPGNYVK PA
9
: Uniquely mapped peptide
: Gene-specific peptide
: Shared peptide

#424, YPRC/BPRC, Industry-University Research Center, Yonsei Univ., Seodaemun-gu, Seoul, Korea, 120-749
Tel: +82-2-2123-6626, Fax: +82-2-393-6589
2014-2020 (C) Yonsei Proteome Research Center