Home| Contact Us

HOME SEARCH STATISTICS
Peptides (NX_O94921-3)
to neXtProt Sequence Information of Isoform
Start-end (length)PeptidesCo#
5-23 (19) NCQGMDSVIKPLDTIPEDK PA
2
30-45 (16) TQSTFDPFEKPANQVK PA
2
47-58 (12) VHSENNACINFK PA
2
72-82 (11) HSSPSSPTSPK PA
2
95-105 (11) LGEGSYATVYK PA
7
122-134 (13) LQEEEGTPFTAIR PA
2
144-157 (14) HANIVLLHDIIHTK PA
7
158-177 (20) ETLTLVFEYVHTDLCQYMDK PA
2
178-188 (11) HPGGLHPDNVK PA
2
189-196 (8) LFLFQLLR PA
5
197-204 (8) GLSYIHQR PA
2
210-225 (16) DLKPQNLLISDTGELK PA
2
226-233 (8) LADFGLAR PA
31
236-290 (55) SVPSHTYSNEVVTLWYRPPDVLLGSTEYSTCLDMWGVGCIFVEMIQGVAAFPGMK PA
2
291-298 (8) DIQDQLER PA
2
299-324 (26) IFLVLGTPNEDTWPGVHSLPHFKPER PA
2
340-352 (13) LSYVNHAEDLASK PA
2
362-379 (18) LSAQAALSHEYFSDLPPR PA
2
380-396 (17) LWELTDMSSIFTVPNVR PA
2
397-406 (10) LQPEAGESMR PA
2
: Uniquely mapped peptide
: Gene-specific peptide
: Shared peptide

#424, YPRC/BPRC, Industry-University Research Center, Yonsei Univ., Seodaemun-gu, Seoul, Korea, 120-749
Tel: +82-2-2123-6626, Fax: +82-2-393-6589
2014-2019 (C) Yonsei Proteome Research Center