Home| Contact Us

HOME SEARCH STATISTICS
Peptides (NX_O95050-1)
to neXtProt Sequence Information of Isoform
Start-end (length)PeptidesCo#
3-13 (11) GGFTGGDEYQK PA
1
19-39 (21) DYLATYYSFDGSPSPEAEMLK PA
1
40-47 (8) FNLECLHK PA
1
48-89 (42) TFGPGGLQGDTLIDIGSGPTIYQVLAACDSFQDITLSDFTDR PA
0
101-112 (12) EPGAYDWTPAVK PA
1
113-123 (11) FACELEGNSGR PA
1
141-177 (37) CDVHLGNPLAPAVLPLADCVLTLLAMECACCSLDAYR PA
1
178-200 (23) AALCNLASLLKPGGHLVTTVTLR PA
1
201-208 (8) LPSYMVGK PA
1
210-218 (9) EFSCVALEK PA
1
219-258 (40) EEVEQAVLDAGFDIEQLLHSPQSYSVTNAANNGVCFIVAR PA
1
: Uniquely mapped peptide
: Gene-specific peptide
: Shared peptide

#424, YPRC/BPRC, Industry-University Research Center, Yonsei Univ., Seodaemun-gu, Seoul, Korea, 120-749
Tel: +82-2-2123-6626, Fax: +82-2-393-6589
2014-2019 (C) Yonsei Proteome Research Center