Home| Contact Us

HOME SEARCH STATISTICS
Peptides (NX_O95050-2)
to neXtProt Sequence Information of Isoform
Start-end (length)PeptidesCo#
3-13 (11) GGFTGGDEYQK PA
1
19-39 (21) DYLATYYSFDGSPSPEAEMLK PA
1
40-47 (8) FNLECLHK PA
1
48-88 (41) TFGPGLQGDTLIDIGSGPTIYQVLAACDSFQDITLSDFTDR PA
0
100-111 (12) EPGAYDWTPAVK PA
1
112-122 (11) FACELEGNSGR PA
1
140-176 (37) CDVHLGNPLAPAVLPLADCVLTLLAMECACCSLDAYR PA
1
177-199 (23) AALCNLASLLKPGGHLVTTVTLR PA
1
200-207 (8) LPSYMVGK PA
1
209-217 (9) EFSCVALEK PA
1
218-257 (40) EEVEQAVLDAGFDIEQLLHSPQSYSVTNAANNGVCFIVAR PA
1
: Uniquely mapped peptide
: Gene-specific peptide
: Shared peptide

#424, YPRC/BPRC, Industry-University Research Center, Yonsei Univ., Seodaemun-gu, Seoul, Korea, 120-749
Tel: +82-2-2123-6626, Fax: +82-2-393-6589
2014-2019 (C) Yonsei Proteome Research Center