Home| Contact Us

HOME SEARCH STATISTICS
Peptides (NX_O95197-5)
to neXtProt Sequence Information of Isoform
Start-end (length)PeptidesCo#
2-40 (40) MAEPSAATQSHSISSSSFGAEPSAPGGGGSPGACPALGTK PA
6
41-55 (15) SCSSSCAVHDLIFWR PA
2
60-98 (39) TGFVFGTTLIMLLSLAAFSVISVVSYLILALLSVTISFR PA
6
102-109 (8) SVIQAVQK PA
6
110-117 (8) SEEGHPFK PA
5
118-144 (27) AYLDVDITLSSEAFHNYMNAAMVHINR PA
5
152-163 (12) LFLVEDLVDSLK PA
5
164-200 (37) LAVFMWLMTYVGAVFNGITLLILAELLIFSVPIVYEK PA
5
217-229 (13) ISTWKPEMQQLLK PA
0
230-241 (12) HHLIVITSLLVL PA
0
: Uniquely mapped peptide
: Gene-specific peptide
: Shared peptide

#424, YPRC/BPRC, Industry-University Research Center, Yonsei Univ., Seodaemun-gu, Seoul, Korea, 120-749
Tel: +82-2-2123-6626, Fax: +82-2-393-6589
2014-2019 (C) Yonsei Proteome Research Center