Home| Contact Us

HOME SEARCH STATISTICS
Peptides (NX_O95199-1)
to neXtProt Sequence Information of Isoform
Start-end (length)PeptidesCo#
2-24 (24) MEEELPLFSGDSGKPVQATLSSLK PA
0
31-46 (16) WPIFSLCSEEELQLIR PA
1
47-90 (44) QACVFGSAGNEVLYTTVNDEIFVLGTNCCGCLGLGDVQSTIEPR PA
1
100-152 (53) IACLSYGSGPHIVLATTEGEVFTWGHNAYSQLGNGTTNHGLVPCHISTNLSNK PA
1
153-196 (44) QVIEVACGSYHSLVLTSDGEVFAWGYNNSGQVGSGSTVNQPIPR PA
1
198-205 (8) VTGCLQNK PA
1
206-250 (45) VVVTIACGQMCCMAVVDTGEVYVWGYNGNGQLGLGNSGNQPTPCR PA
1
251-258 (8) VAALQGIR PA
1
262-294 (33) VACGYAHTLVLTDEGQVYAWGANSYGQLGTGNK PA
1
295-307 (13) SNQSYPTPVTVEK PA
1
310-325 (16) IIEIAACHSTHTSAAK PA
1
326-338 (13) TQGGHVYMWGQCR PA
3
339-368 (30) GQSVILPHLTHFSCTDDVFACFATPAVTWR PA
1
369-385 (17) LLSVEPDDHLTVAESLK PA
1
387-397 (11) EFDNPDTADLK PA
1
421-442 (22) SSLEDNEDDIVEMSEFSYPVYR PA
1
443-471 (29) AFLEYLYTDSISLSPEEAVGLLDLATFYR PA
1
485-501 (17) QGICEENAIALLSAAVK PA
1
502-513 (12) YDAQDLEEFCFR PA
1
514-537 (24) FCINHLTVVTQTSGFAEMDHDLLK PA
1
: Uniquely mapped peptide
: Gene-specific peptide
: Shared peptide

#424, YPRC/BPRC, Industry-University Research Center, Yonsei Univ., Seodaemun-gu, Seoul, Korea, 120-749
Tel: +82-2-2123-6626, Fax: +82-2-393-6589
2014-2020 (C) Yonsei Proteome Research Center