Home| Contact Us

HOME SEARCH STATISTICS
Peptides (NX_O95199-2)
to neXtProt Sequence Information of Isoform
Start-end (length)PeptidesCo#
7-22 (16) WPIFSLCSEEELQLIR PA
1
23-66 (44) QACVFGSAGNEVLYTTVNDEIFVLGTNCCGCLGLGDVQSTIEPR PA
1
76-128 (53) IACLSYGSGPHIVLATTEGEVFTWGHNAYSQLGNGTTNHGLVPCHISTNLSNK PA
1
129-172 (44) QVIEVACGSYHSLVLTSDGEVFAWGYNNSGQVGSGSTVNQPIPR PA
1
174-181 (8) VTGCLQNK PA
1
182-226 (45) VVVTIACGQMCCMAVVDTGEVYVWGYNGNGQLGLGNSGNQPTPCR PA
1
227-234 (8) VAALQGIR PA
1
238-270 (33) VACGYAHTLVLTDEGQVYAWGANSYGQLGTGNK PA
1
271-283 (13) SNQSYPTPVTVEK PA
1
286-301 (16) IIEIAACHSTHTSAAK PA
1
302-314 (13) TQGGHVYMWGQCR PA
3
315-344 (30) GQSVILPHLTHFSCTDDVFACFATPAVTWR PA
1
345-361 (17) LLSVEPDDHLTVAESLK PA
1
363-373 (11) EFDNPDTADLK PA
1
397-418 (22) SSLEDNEDDIVEMSEFSYPVYR PA
1
419-447 (29) AFLEYLYTDSISLSPEEAVGLLDLATFYR PA
1
461-477 (17) QGICEENAIALLSAAVK PA
1
478-489 (12) YDAQDLEEFCFR PA
1
490-513 (24) FCINHLTVVTQTSGFAEMDHDLLK PA
1
: Uniquely mapped peptide
: Gene-specific peptide
: Shared peptide

#424, YPRC/BPRC, Industry-University Research Center, Yonsei Univ., Seodaemun-gu, Seoul, Korea, 120-749
Tel: +82-2-2123-6626, Fax: +82-2-393-6589
2014-2020 (C) Yonsei Proteome Research Center