Home| Contact Us

HOME SEARCH STATISTICS
Peptides (NX_O95229-2)
to neXtProt Sequence Information of Isoform
Start-end (length)PeptidesCo#
2-37 (37) MEAAETEAEAAALEVLAEVAGILEPVGLQEEAELPAK PA
1
38-48 (11) ILVEFVVDSQK PA
1
52-74 (23) LLCSQLQVADFLQNILAQEDTAK PA
1
75-86 (12) GLDPLASEDTSR PA
1
117-126 (10) ALTQMEEAQR PA
1
133-141 (9) EAFEQLQAK PA
1
151-162 (12) AVQNQWQLQQEK PA
1
163-175 (13) HLQHLAEVSAEGK PA
0
176-210 (35) LLFPEAEAEAENLPDDKPQQPTRPQEQSTGDTMGR PA
1
218-230 (13) AVGLQPAGDVNLP PA
1
: Uniquely mapped peptide
: Gene-specific peptide
: Shared peptide

#424, YPRC/BPRC, Industry-University Research Center, Yonsei Univ., Seodaemun-gu, Seoul, Korea, 120-749
Tel: +82-2-2123-6626, Fax: +82-2-393-6589
2014-2020 (C) Yonsei Proteome Research Center