Home| Contact Us

HOME SEARCH STATISTICS
Peptides (NX_O95237-1)
to neXtProt Sequence Information of Isoform
Start-end (length)PeptidesCo#
3-15 (13) NPMLEVVSLLLEK PA
0
16-34 (19) LLLISNFTLFSSGAAGEDK PA
0
37-47 (11) NSFYETSSFHR PA
0
48-55 (8) GDVLEVPR PA
0
56-69 (14) THLTHYGIYLGDNR PA
0
70-87 (18) VAHMMPDILLALTDDMGR PA
0
97-104 (8) LILGVIVK PA
0
110-133 (24) VDTVEDFAYGANILVNHLDESLQK PA
0
135-143 (9) ALLNEEVAR PA
0
148-169 (22) LLGFTPYSLLWNNCEHFVTYCR PA
0
170-180 (11) YGTPISPQSDK PA
0
194-230 (37) SVLASAVLGLASIVCTGLVSYTTLPAIFIPFFLWMAG PA
0
: Uniquely mapped peptide
: Gene-specific peptide
: Shared peptide

#424, YPRC/BPRC, Industry-University Research Center, Yonsei Univ., Seodaemun-gu, Seoul, Korea, 120-749
Tel: +82-2-2123-6626, Fax: +82-2-393-6589
2014-2019 (C) Yonsei Proteome Research Center