Home| Contact Us

HOME SEARCH STATISTICS
Peptides (NX_O95363-1)
to neXtProt Sequence Information of Isoform
Start-end (length)PeptidesCo#
9-19 (11) GAHAYVYLVSK PA
0
26-45 (20) GHQHQAWGSRPPAAECATQR PA
0
46-56 (11) APGSVVELLGK PA
0
57-68 (12) SYPQDDHSNLTR PA
0
77-90 (14) NLHNQQHHPLWLIK PA
0
105-138 (34) FGTPLFSVYDNLSPVVTTWQNFDSLLIPADHPSR PA
0
141-148 (8) GDNYYLNR PA
0
154-179 (26) AHTSAHQWDLLHAGLDAFLVVGDVYR PA
0
181-198 (18) DQIDSQHYPIFHQLEAVR PA
0
203-210 (8) HELFAGIK PA
0
211-223 (13) DGESLQLFEQSSR PA
0
228-237 (10) QETHTMEAVK PA
0
250-262 (13) LMAHLFGDELEIR PA
0
263-307 (45) WVDCYFPFTHPSFEMEINFHGEWLEVLGCGVMEQQLVNSAGAQDR PA
0
308-318 (11) IGWAFGLGLER PA
0
319-330 (12) LAMILYDIPDIR PA
0
331-338 (8) LFWCEDER PA
0
342-351 (10) QFCVSNINQK PA
0
360-386 (27) YPAVINDISFWLPSENYAENDFYDLVR PA
0
387-395 (9) TIGGDLVEK PA
0
432-450 (19) HIHQALQEAAVQLLGVEGR PA
0
: Uniquely mapped peptide
: Gene-specific peptide
: Shared peptide

#424, YPRC/BPRC, Industry-University Research Center, Yonsei Univ., Seodaemun-gu, Seoul, Korea, 120-749
Tel: +82-2-2123-6626, Fax: +82-2-393-6589
2014-2019 (C) Yonsei Proteome Research Center