Home| Contact Us

HOME SEARCH STATISTICS
Peptides (NX_O95416-1)
to neXtProt Sequence Information of Isoform
Start-end (length)PeptidesCo#
2-9 (9) MSKPSDHIK PA
0
10-20 (11) RPMNAFMVWSR PA
4
33-40 (8) MHNSEISK PA
6
55-62 (8) RPYIDEAK PA
0
92-106 (15) YVFPLPYLGDTDPLK PA
0
107-124 (18) AAGLPVGASDGLLSAPEK PA
0
127-151 (25) AFLPPASAPYSLLDPAQFSSSAIQK PA
0
152-226 (75) MGEVPHTLATGALPYASTLGYQNGAFGSLSCPSQHTHTHPSPTNPGYVVPCNCTAWSASTLQPPVAYILFPGMTK PA
0
227-240 (14) TGIDPYSSAHATAM PA
0
: Uniquely mapped peptide
: Gene-specific peptide
: Shared peptide

#424, YPRC/BPRC, Industry-University Research Center, Yonsei Univ., Seodaemun-gu, Seoul, Korea, 120-749
Tel: +82-2-2123-6626, Fax: +82-2-393-6589
2014-2019 (C) Yonsei Proteome Research Center