Home| Contact Us

HOME SEARCH STATISTICS
Peptides (NX_O95466-2)
to neXtProt Sequence Information of Isoform
Start-end (length)PeptidesCo#
2-20 (20) MGNAAGSAEQPAGPAAPPPK PA
2
27-38 (12) QPMPAAGELEER PA
2
42-52 (11) ALNCMNLPPDK PA
2
53-63 (11) VQLLSQYDNEK PA
2
65-73 (9) WELICDQER PA
4
78-86 (9) NPPAAYIQK PA
2
89-98 (10) SYVDTGGVSR PA
2
100-111 (12) VAADWMSNLGFK PA
2
114-122 (9) VQESTQVLR PA
4
130-145 (16) TNHIGWVQEFLNEENR PA
2
146-177 (32) GLDVLLEYLAFAQCSVTYDMESTDNGASNSEK PA
2
178-190 (13) NKPLEQSVEDLSK PA
2
191-198 (8) GPPSSVPK PA
2
225-235 (11) DDVHVCIMCLR PA
4
236-264 (29) AIMNYQSGFSLVMNHPACVNEIALSLNNK PA
2
270-283 (14) ALVLELLAAVCLVR PA
7
284-297 (14) GGHDIILAAFDNFK PA
2
298-305 (8) EVCGEQHR PA
2
315-343 (29) NEDSNIDFMVACMQFINIVVHSVENMNFR PA
2
344-361 (18) VFLQYEFTHLGLDLYLER PA
2
370-394 (25) LQVQIQAYLDNIFDVGALLEDTETK PA
2
395-414 (20) NAVLEHMEELQEQVALLTER PA
2
417-425 (9) DAENESMAK PA
2
447-457 (11) FSESTAMGPSR PA
2
465-479 (15) APPAAPTRPSALELK PA
2
494-621 (128) GPGDAVSIEILPVAVATPSGGDAPTPGVPTGSPSPDLAPAAEPAPGAAPPPPPPLPGLPSPQEAPPSAPPQAPPLPGSPE
PPPAPPLPGDLPPPPPPPPPPPGTDGPVPPPPPPPPPPPGGPPDALGR PA
2
623-631 (9) DSELGPGVK PA
2
642-667 (26) MPLLNWVALKPSQITGTVFTELNDEK PA
2
668-682 (15) VLQELDMSDFEEQFK PA
2
685-696 (12) SQGPSLDLSALK PA
2
707-714 (8) ATLIEANR PA
2
732-754 (23) ICQAIEAYDLQALGLDFLELLMR PA
2
755-762 (8) FLPTEYER PA
2
771-783 (13) EQRPMEELSEEDR PA
2
798-829 (32) MTTLTFLGNFPDTAQLLMPQLNAIIAASMSIK PA
2
836-852 (17) QILEIVLAFGNYMNSSK PA
2
861-871 (11) LQSLDALLEMK PA
2
877-885 (9) QTLLHYLVK PA
2
891-906 (16) YPQLTGFHSDLHFLDK PA
2
907-920 (14) AGSVSLDSVLADVR PA
2
936-943 (8) QDDCMVLK PA
2
948-955 (8) ANSPTMDK PA
2
962-979 (18) TAQEAFESVVEYFGENPK PA
2
980-992 (13) TTSPGLFFSLFSR PA
2
1000-1008 (9) AEQEVEQWK PA
2
1010-1023 (14) EAAAQEAGADTPGK PA
2
1037-1047 (11) RPQMDLISELK PA
2
1053-1061 (9) EPLIYESDR PA
2
1062-1073 (12) DGAIEDIITDLR PA
1
1090-1104 (15) RPPGPPLQVTSDLSL PA
0
: Uniquely mapped peptide
: Gene-specific peptide
: Shared peptide

#424, YPRC/BPRC, Industry-University Research Center, Yonsei Univ., Seodaemun-gu, Seoul, Korea, 120-749
Tel: +82-2-2123-6626, Fax: +82-2-393-6589
2014-2019 (C) Yonsei Proteome Research Center