Home| Contact Us

HOME SEARCH STATISTICS
Peptides (NX_O95630-1)
to neXtProt Sequence Information of Isoform
Start-end (length)PeptidesCo#
2-14 (14) MSDHGDVSLPPEDR PA
1
17-34 (18) ALSQLGSAVEVNEDIPPR PA
1
46-65 (20) MASIYSEEGNIEHAFILYNK PA
1
66-73 (8) YITLFIEK PA
1
117-125 (9) EYTEYNEEK PA
1
135-144 (10) NMAIQQELEK PA
1
154-170 (17) QQQLEQEQFHAFEEMIR PA
1
188-235 (48) VDPGLGGPLVPDLEKPSLDVFPTLTVSSIQPSDCHTTVRPAKPPVVDR PA
1
236-255 (20) SLKPGALSNSESIPTIDGLR PA
1
263-277 (15) LCPQFLQLASANTAR PA
1
278-288 (11) GVETCGILCGK PA
1
292-303 (12) NEFTITHVLIPK PA
1
304-370 (67) QSAGSDYCNTENEEELFLIQDQQGLITLGWIHTHPTQTAFLSSVDLHTHCSYQMMLPESVAIVCSPK PA
0
371-378 (8) FQETGFFK PA
0
379-391 (13) LTDHGLEEISSCR PA
0
401-416 (16) DPPLFCSCSHVTVVDR PA
0
417-424 (8) AVTITDLR PA
0
: Uniquely mapped peptide
: Gene-specific peptide
: Shared peptide

#424, YPRC/BPRC, Industry-University Research Center, Yonsei Univ., Seodaemun-gu, Seoul, Korea, 120-749
Tel: +82-2-2123-6626, Fax: +82-2-393-6589
2014-2019 (C) Yonsei Proteome Research Center