Home| Contact Us

HOME SEARCH STATISTICS
Peptides (NX_O95780-1)
to neXtProt Sequence Information of Isoform
Start-end (length)PeptidesCo#
8-30 (23) DVTIEFSLEEWEFLNPAQQSLYR PA
0
39-55 (17) NLVSLGLTVSKPELISR PA
1
68-97 (30) HETIAKPPAMSSHYTEDLLPEQCMQDSFQK PA
1
103-114 (12) YGSCGLEDLHLR PA
2
116-124 (9) DGENVGECK PA
2
128-143 (16) EIYNGLNQCLSTLPSK PA
2
184-192 (9) SHSGLSYHK PA
2
200-208 (9) LCICEECGK PA
2
222-230 (9) IHTGEKPYK PA
242
237-246 (10) AFNWCSSLTK PA
2
250-258 (9) IHTGEKPYK PA
242
265-274 (10) AFHWCSPFVR PA
2
278-292 (15) IHTGEKPYTCEDCGR PA
2
321-333 (13) AFNHCSLLTIHER PA
2
334-342 (9) THTGEKPYK PA
107
349-360 (12) AFNSSSILTEHK PA
2
361-370 (10) VIHSGEKPYK PA
3
390-398 (9) IHTGEKPYK PA
242
405-416 (12) AFNWSSILTEHK PA
2
418-432 (15) IHTGEKPYNCEECGK PA
5
465-472 (8) CSHLNEHK PA
2
486-498 (13) CGEAFNHCSNLTT PA
2
: Uniquely mapped peptide
: Gene-specific peptide
: Shared peptide

#424, YPRC/BPRC, Industry-University Research Center, Yonsei Univ., Seodaemun-gu, Seoul, Korea, 120-749
Tel: +82-2-2123-6626, Fax: +82-2-393-6589
2014-2019 (C) Yonsei Proteome Research Center